Teriparatide, CAS No: 52232-67-4

• CAS No.: 52232-67-4
• Formula: C172h278n52o47s2
• EINECS: 640-978-1
• Type: Pharmaceutical Intermediates
• Appearance: Powder
• Colour: White
• HS Code: 2937190090
• Production Capacity: 100000g/Month

Product Description

  Teriparatide (Human parathyroid hormone-(1-34)) is a PTH1 receptor agonist. Teriparatide (Human parathyroid hormone-(1-34)) can be used for osteoporosis research.

Product Introduction

Genertic name	Teriparatide
Synonyms	PTH (HUMAN, 1-34); PTH (1-34) (HUMAN); Teriparatide acetate; PARATHYROID HORMONE   (HUMAN, 1-34); PARATHYROID HORMONE (1-34),HUMAN;    SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
CAS No.	52232-67-4
EINECS	640-978-1

  Chemical Properties

Formula	C172H278N52O47S2
Molecular Weight	3890.49792
Melting Point	>205oC (dec.)
Solubility	DMSO (Slightly), Water (Slightly)
Appearance	White to Off-White powder
Storage Condition	−20°C

Application & Efficacy

    Teriparatide is a commonly used drug indicated for the treatment of osteoporosis in postmenopausal women. Teriparatide can also upregulate Ang-1 expression through the AC/PKA signaling pathway to promote angiogenesis. At present, promoting angiogenesis is a promising but unrealized strategy for the treatment of ischemic cerebral infarction. However, there are few studies on the application of teriparatide in the treatment of cerebral infarction. We used teriparatide to treat ischemic cerebral infarction in rats and obtained three major findings. First, teriparatide can promote angiogenesis, reduce cerebral infarct size, and increase cerebral perfusion by upregulating Ang-1 expression. Second, teriparatide can promote the expression of HO1, SOD2 and inhibit the production of pro-inflammatory cytokines IL-1β, IL-6 by upregulating Nrf2 expression. Third, we further found that teriparatide can mitigate blood-brain barrier disruption and brain edema by downregulating the expressions of MMP9, Ang-2 and AQP4. Our results indicate that teriparatide is neuroprotective through multiple mechanisms of action that include promoting angiogenesis,inhibiting oxidative stress and neuroinflammation, protecting blood-brain barrier, and reducing brain edema.